Protein Info for BT2149 in Bacteroides thetaiotaomicron VPI-5482

Annotation: dihydroneopterin aldolase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 122 TIGR00526: FolB domain" amino acids 8 to 119 (112 residues), 62.5 bits, see alignment E=4.4e-21 PF02152: FolB" amino acids 8 to 118 (111 residues), 117.4 bits, see alignment E=2.4e-38 TIGR00525: dihydroneopterin aldolase" amino acids 8 to 119 (112 residues), 98.8 bits, see alignment E=2.8e-32

Best Hits

Swiss-Prot: 41% identical to FOLB_STAEQ: Dihydroneopterin aldolase (folB) from Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

KEGG orthology group: K01633, dihydroneopterin aldolase [EC: 4.1.2.25] (inferred from 100% identity to bth:BT_2149)

Predicted SEED Role

"Dihydroneopterin aldolase (EC 4.1.2.25)" in subsystem Folate Biosynthesis (EC 4.1.2.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A5T9 at UniProt or InterPro

Protein Sequence (122 amino acids)

>BT2149 dihydroneopterin aldolase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKINNSYILLKDICCFAYHGVAPQENIIGNEYIINLKLKVDISQAIQTDDVVDTVNYAEI
HEAVKAEMSIPSKLLEHVCGRIAKRLLAEFPAIEEIELRLSKRNPPMGADIDSAGVELHC
SR