Protein Info for BT2143 in Bacteroides thetaiotaomicron VPI-5482

Annotation: chromosomal replication initiator protein dnaA (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 PF11638: DnaA_N" amino acids 9 to 68 (60 residues), 57.1 bits, see alignment E=3.6e-19 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 10 to 464 (455 residues), 490.4 bits, see alignment E=2.8e-151 PF00308: Bac_DnaA" amino acids 132 to 348 (217 residues), 253.3 bits, see alignment E=7.4e-79 PF01695: IstB_IS21" amino acids 169 to 271 (103 residues), 33.8 bits, see alignment E=7.7e-12 PF00910: RNA_helicase" amino acids 170 to 242 (73 residues), 24.5 bits, see alignment E=9.5e-09 PF00004: AAA" amino acids 170 to 275 (106 residues), 27.5 bits, see alignment E=1.2e-09 PF08299: Bac_DnaA_C" amino acids 377 to 445 (69 residues), 97.6 bits, see alignment E=1.1e-31

Best Hits

Swiss-Prot: 100% identical to DNAA_BACTN: Chromosomal replication initiator protein DnaA (dnaA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 100% identity to bth:BT_2143)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A5U5 at UniProt or InterPro

Protein Sequence (470 amino acids)

>BT2143 chromosomal replication initiator protein dnaA (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MIESNHVVLWNRCLEVIKDNVPETTYNTWFAPIVPLKYEDKTLIVQIPSQFFYEILEEKF
VDLLRKTLYKAIGEGTKLMYNVMVDKTSIPNQTVNLEASNRSTAVTPKSIVGGNKAPSFL
KAPAVQDLDPHLNPNYNFENFIEGYSNKLSRSVAEAVAQNPAGTAFNPLFLYGASGVGKT
HLANAIGTKIKELYADKRVLYVSAHLFQVQYTDSVRNNTTNDFINFYQTIDVLIIDDIQE
FAGVTKTQNTFFHIFNHLHQNGKQLILTSDRAPVLLQGMEERLLTRFKWGMVAELEKPTV
ELRKNILRNKIHRDGLQFPPEVIDYIAENVNESVRDLEGIVIAIMARSTIFNKEIDLDLA
QHIVHGVVHNETKAVTIDDILKVVCKHFDLEASAIHTKSRKREVVQARQIAMYLAKNYTD
FSTSKIGKFIGNKDHATVLHACKTVKGQLEVDKSFQAEVQEIESLLKKKA