Protein Info for BT2106 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative transmembrane hexose transporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 161 to 179 (19 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 245 to 263 (19 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 295 to 317 (23 residues), see Phobius details amino acids 328 to 346 (19 residues), see Phobius details amino acids 358 to 376 (19 residues), see Phobius details PF07690: MFS_1" amino acids 13 to 342 (330 residues), 92.1 bits, see alignment E=1.7e-30

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_2106)

Predicted SEED Role

"Predicted glucose transporter in maltodextrin utilization gene cluster" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A5Y0 at UniProt or InterPro

Protein Sequence (386 amino acids)

>BT2106 putative transmembrane hexose transporter (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKNKSKILPVLFGFFIMGFCDLVGVSVTYAKDYFSWSETQAGFLPSMVFIWFLLISIPIS
IWMDKKGRKTISLIGLLSTFIGMLLPLLTFTQTACYIAFALLGIGNTILQVSLNPLLTNV
IAEGKLSSIMTAGQFIKALSSFVGPIVAGFCSVYFNNWILMFPIFAAITLISGIWLFFTP
INEKDDKRLTSSFYQVISLLKNKTICLLFGGIICIVGLDVGMNVFTPKLLIENAELTKEI
ASYGTSWYFAARTLGTLCGVILLAKFSEIYYYRINMFIVLIALSCIYWIHSQYIILLLVC
IIAFAMSSIFAVIYSLALHTLPYKTNEISGLMITGISGGSIIPPLMGVCADYTESQSGSI
LVMLICVIYLILCSFHKFKTIHTKPH