Protein Info for BT2099 in Bacteroides thetaiotaomicron VPI-5482

Annotation: Fe3+ ABC transporter, permease (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 67 to 90 (24 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 127 to 151 (25 residues), see Phobius details amino acids 172 to 200 (29 residues), see Phobius details amino acids 220 to 246 (27 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details PF01032: FecCD" amino acids 2 to 304 (303 residues), 247.3 bits, see alignment E=9.7e-78

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to bth:BT_2099)

Predicted SEED Role

"Vitamin B12 ABC transporter, permease component BtuC" in subsystem Coenzyme B12 biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A5Y7 at UniProt or InterPro

Protein Sequence (312 amino acids)

>BT2099 Fe3+ ABC transporter, permease (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MATGDTYIPIPKVWAVLTGGECDEMTRNILLSIRFIRVVVAGLIGIALSVSGLQMQTVFQ
NPLADPYLLGVSSGAGLGVALFILGAPLLGWADFPLLQSAGIVGSGWIGTAVILLGVAII
SRKVKNILGVLIMGVMIGYVAGAIIQILQYLSSAEQLKMFTLWSMGSLSHITAGQLSIMI
PVVCIGLLLSVACIKSLNLLLLGENYARTMGMSIKRSRTLVFISTALLTGTVTAFCGPVG
FIGLAVPHITRLLFDNADHRILMPGTMLTGLIAMLICDIIAKKFLLPVNCITALLGVPVI
LWVIGKNLRIFK