Protein Info for BT2084 in Bacteroides thetaiotaomicron VPI-5482

Annotation: chorismate synthase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 334 to 351 (18 residues), see Phobius details PF01264: Chorismate_synt" amino acids 9 to 351 (343 residues), 460.6 bits, see alignment E=1.1e-142 TIGR00033: chorismate synthase" amino acids 9 to 354 (346 residues), 453 bits, see alignment E=3.1e-140

Best Hits

Swiss-Prot: 100% identical to AROC_BACTN: Chorismate synthase (aroC) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01736, chorismate synthase [EC: 4.2.3.5] (inferred from 100% identity to bth:BT_2084)

Predicted SEED Role

"Chorismate synthase (EC 4.2.3.5)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 4.2.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A602 at UniProt or InterPro

Protein Sequence (358 amino acids)

>BT2084 chorismate synthase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MFNSFGNIFRLTSFGESHGKGVGGVIDGFPSGITIDEEFVQQELNRRRPGQSILTTPRKE
ADKVEFLSGIFEGKSTGCPIGFIVWNENQHSNDYNNLKEVYRPSHADYTYKVKYGIRDHR
GGGRSSARETISRVVAGALAKLALRQLGISITAYTSQVGAIKLEGTYSDYDLDLIETNDV
RCPDPEKAKEMADLIYKVKGEGDTIGGTLTCVIKGCPIGLGQPVFGKLHAALGNAMLSIN
AAKAFEYGEGFKGLKMKGSEQNDVFFNNNGRIETHTNHSGGIQGGISNGQDIYFRVVFKP
IATLLMEQETVNIDGVDTTLKARGRHDACVLPRAVPIVEAMAAMTILDYYLLDKTTQL