Protein Info for BT2023 in Bacteroides thetaiotaomicron VPI-5482

Annotation: two-component system sensor histidine kinase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 720 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 188 to 207 (20 residues), see Phobius details PF00512: HisKA" amino acids 495 to 561 (67 residues), 70.4 bits, see alignment E=1.7e-23 PF02518: HATPase_c" amino acids 608 to 714 (107 residues), 95.9 bits, see alignment E=3.2e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_2023)

Predicted SEED Role

"Two-component system sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A663 at UniProt or InterPro

Protein Sequence (720 amino acids)

>BT2023 two-component system sensor histidine kinase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MEARITRKTAALAIFLISAFQTYIYAGRPSSCQLLIINSYTENCLWSDDFMAPVYKEFRV
QNSPVDICAEHMELMATVVPDMRKQVFMSDRRWISAQCRKEAEEVMPFLLIGGYFWTDSE
IKKHLLPVIKSRLDGASHPHRVETTAMGTPPSVINYADYVESGLLLGLCPDDTVFGMKPP
TFFERNKYYLALFFSLMALAVIYVIWLRRALHERSRLLEIMRSYSSLVENMPVLYARVEL
IFDPGGRIIDYVYREVNPTFEKYILPKEKILGKKYSELNPDYSPELPDRYSELNDNRQIT
FQYYLEKTKTHLTVISIHSKTKGCVDVFGVDNTELVLTQQMLKSTNHKLSAALDAADMTP
WKWDLRTGLLSCNVSHDLYVTEEEVTHDGNLIIVPTSACFAKICDEDRERVRDAFEHLAN
GETQKMREEYRVGRQWLPSPQQNEWVEVRAAVDERDANGKPLSLIGTSMTVTQRKEMEEA
LVQAKVKAEEANTLKSSFLANISHEIRTPLNAIVGFSSLLVSAERGISEEKQEYINIIEN
NNTLLLQLISDVLDLSKIEAGTMEFDYAPIDVHGLFIELEDTFRLRNKKSGICICYHRRT
TECVVKADRNRLVQVMMNLMNNAVKFTGEGSIEFGFDVREDGFLHFYVTDTGCGIPEERL
EEIFGNFVKLNSFVQGTGLGLTICRAIVERMGGKIGAVSRLGQGSTFWFTLPYTANEEKI