Protein Info for BT1996 in Bacteroides thetaiotaomicron VPI-5482

Annotation: transposase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 PF00872: Transposase_mut" amino acids 15 to 381 (367 residues), 332.4 bits, see alignment E=1.7e-103

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0280)

Predicted SEED Role

"transposase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>BT1996 transposase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MDRNSEEYQQMRDKALSQLRSGESLTGKDGAFGPLLKEFLEAALDGEMSSHLDDSERLKG
NKRNGRGSKRVKTMAGEIDIVTPQDRHSSFSPEILKKRETILADNMSSKIISLYGMGLSL
RDISSHIEEMYDVEISHNTLSEIIERIVPKVKEWQSRPLESMYTIVWLDAMHYKVKDGGR
TESRAVYNVLAVNKDGHKELIGMYVSESEGANFWLSVLTDLKARGMKDVLIACIDNLTGF
AEAISTIFPEVIIQNCVIHQIRNSLKYIASKDQKEFMADLKTVYQAPNKDLAELNLDKLQ
DKWGKKYPVVLESWRRNWDNLSAYFAYDEHIRRLIYTTNAVEGFHRQVRKVTKTKGVFPN
DMALMKLIYLAVMNISKKWTQPLQNWALTAGQLRIKFGERMPLAI