Protein Info for BT1983 in Bacteroides thetaiotaomicron VPI-5482

Annotation: hemolysin III (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 26 to 50 (25 residues), see Phobius details amino acids 57 to 78 (22 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details PF03006: HlyIII" amino acids 21 to 222 (202 residues), 164.8 bits, see alignment E=1.3e-52

Best Hits

KEGG orthology group: K11068, hemolysin III (inferred from 100% identity to bth:BT_1983)

Predicted SEED Role

"COG1272: Predicted membrane protein hemolysin III homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A6A2 at UniProt or InterPro

Protein Sequence (229 amino acids)

>BT1983 hemolysin III (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MYLCGSNQSRKETLENKRYNNVEEWANTLSHGAGILLGVIAGYFLLAKAAAGAEPKWAVA
CVTVYLFGMLSSYVSSTWYHGSRPGKLKELLRKFDHGAIYLHIAGTYTPFTLLVMRHAGG
WGWGIFSFVWLSAIVGFILSFKKLKEHSNLETACYIAMGACILVAMKPLMDHLAEMGAGP
AFWWLIGGGVSYIIGAVFYSLRKPYMHATFHLFCLGGSIGHIIAIWLIL