Protein Info for BT1879 in Bacteroides thetaiotaomicron VPI-5482

Annotation: protease IV (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 transmembrane" amino acids 7 to 34 (28 residues), see Phobius details TIGR00705: signal peptide peptidase SppA, 67K type" amino acids 20 to 547 (528 residues), 480.8 bits, see alignment E=5.5e-148 PF01343: Peptidase_S49" amino acids 125 to 279 (155 residues), 116.4 bits, see alignment E=1.8e-37 amino acids 375 to 524 (150 residues), 165.1 bits, see alignment E=1.9e-52 TIGR00706: signal peptide peptidase SppA, 36K type" amino acids 332 to 522 (191 residues), 206.5 bits, see alignment E=3.7e-65 PF00574: CLP_protease" amino acids 334 to 402 (69 residues), 22.2 bits, see alignment E=1.7e-08 PF01972: SDH_protease" amino acids 335 to 416 (82 residues), 34.4 bits, see alignment E=1.8e-12

Best Hits

KEGG orthology group: K04773, protease IV [EC: 3.4.21.-] (inferred from 100% identity to bth:BT_1879)

Predicted SEED Role

"Protease IV (EC 3.4.21.-)" (EC 3.4.21.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A6K2 at UniProt or InterPro

Protein Sequence (592 amino acids)

>BT1879 protease IV (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKDFLKFTLATVTGIILSSIVLFIIGMVTLFGIVSTADTETIVKKNSVMMLDLNGVLVER
TQESPLGILSQLFSDDSNTYGLDDILSSIKKAKENENIKGIYLQASMLGTSYASLQEIRN
ALLDFKESGKFIIAYGDSYTQGLYYLSSVADKVLLNPKGMIEWKGIASAPLFYKDLLQKI
GVEMQIFKVGTYKSAVEPFISTEMSPANREQVTAFINSIWGQVTEGVSASRSLPVDSLNA
LADRMLMFYPAEESVQCGLADTLIYRNDVRNYLKQWVDLKEDDRLPVLGLSDMINVKKNM
PKDKSGNIVAVYYASGEITDYSGSSTSEEGIVGTKVIRDLRKLKDDEDVKAVVLRVNSPG
GSAFASEQIWHAVKELKTEKPVIVSMGDYAASGGYYISCVADTIVAEPTTLTGSIGIFGM
VPNVKELSEKIGLTYDVVKTNKFSDFGNIMRPFNQDEKTLMQMMITQGYDTFVNRCAEGR
HMSKEAIEKIAEGRVWTGEAAKELGLVDVLGGIDTALEIAVRKAGIEGYTVVSYPAKQDL
LSSLLNTKPTNYVESQILKSKLGEYYQQFGMLKNLKERSMIQARIPFELNIK