Protein Info for BT1854 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative membrane-associated phospholipid phosphatase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 26 to 49 (24 residues), see Phobius details amino acids 56 to 79 (24 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 136 to 156 (21 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details amino acids 205 to 223 (19 residues), see Phobius details PF01569: PAP2" amino acids 63 to 182 (120 residues), 74.1 bits, see alignment E=9.3e-25 PF14378: PAP2_3" amino acids 111 to 170 (60 residues), 30 bits, see alignment E=4.3e-11

Best Hits

Swiss-Prot: 100% identical to LPXF_BACTN: Lipid A 4'-phosphatase (lpxF) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: None (inferred from 100% identity to bth:BT_1854)

Predicted SEED Role

"putative membrane-associated phospholipid phosphatase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A6M3 at UniProt or InterPro

Protein Sequence (225 amino acids)

>BT1854 putative membrane-associated phospholipid phosphatase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MIEFLSDIDTQLLLFFNGIHSPFWDYFMSAFTGKVIWVPMYASILYILLKNFHWKVALCY
VVAIALTITFADQMCNSFLRPLVGRLRPSNPENPIADLVYIVNGRRGGGFGFPSCHAANS
FGLAIFLICLFRKRWLSIFIVLWAFTNSYTRLYLGLHYPGDLVAGAIIGGFGGWLFYFIA
HKLTARLQSDTPVPGKGAGMKQTEVMIYTGLLTLAGIIIYSIVQS