Protein Info for BT1850 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 53 to 75 (23 residues), see Phobius details amino acids 95 to 115 (21 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 168 to 186 (19 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 304 to 321 (18 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 5 to 348 (344 residues), 169.9 bits, see alignment E=3.9e-54

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1850)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A6M7 at UniProt or InterPro

Protein Sequence (362 amino acids)

>BT1850 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKRIVFLDYVRVFACFLVMVVHASENFYGAAGSTDMAGPQSFLASEADRLWVAVYDGFSR
MAVPLFMIVSAYLLVPMKEGQTSWQFYRRRFTHILPPFFIFMILYSILPMLWGQIDSETS
IKDMSRIFLNFPTLAGHLWFMYPLISLYLFIPIISPWLSKATAKEERFFIGLFLLSTCMP
YFNRWFGEVWGQCFWNEYHMLWYFSGYLGYLVLAHYIRVHLKWDRSKRFIVGLISMVAGA
ALTIYSFYIQAIPGITHSTPVIEIGWAFCTINCVLLTAGTFLLFTCINRPEAPRFVTDMS
KLSYGMYLMHIFWLGLWATVFKNTLELPTVSAIPCIAVTTFVCCYITTKIISFIPGSKWI
IG