Protein Info for BT1806 in Bacteroides thetaiotaomicron VPI-5482

Annotation: acyl-CoA dehydrogenase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 PF02771: Acyl-CoA_dh_N" amino acids 91 to 169 (79 residues), 46.9 bits, see alignment E=8.6e-16 PF02770: Acyl-CoA_dh_M" amino acids 173 to 268 (96 residues), 88 bits, see alignment E=9.5e-29 PF00441: Acyl-CoA_dh_1" amino acids 283 to 444 (162 residues), 104 bits, see alignment E=2.1e-33 PF08028: Acyl-CoA_dh_2" amino acids 294 to 439 (146 residues), 55.4 bits, see alignment E=2.1e-18 PF12186: AcylCoA_dehyd_C" amino acids 452 to 563 (112 residues), 146.2 bits, see alignment E=1e-46

Best Hits

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 100% identity to bth:BT_1806)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.8.7 or 1.3.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A6S0 at UniProt or InterPro

Protein Sequence (568 amino acids)

>BT1806 acyl-CoA dehydrogenase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MANFYTEIPELKYHLNNPMMKRICELKERNYRDKDEFDYAPLDFEDALDSYDKVLEITGE
ITGEIINANAEGVDEEGPHCANGRVEYASGTKENLDAMVKAGLNGMTMPRRFGGLNFPIT
PYTMCAEIVAAADAGFGNIWSLQDCIETLYEFGNADQHSRFIPRVCQGETMSMDLTEPDA
GSDLQAVMLKATYSEKDGCWLLNGVKRFITNGDADIHLVLARSEEGTRDGRGLSMFIYDK
RQGGVDVRRIEHKLGIHGSPTCELVYKNAKAELCGDRKLGLIKYVMALMNGARLGIAAQS
VGLSQAAYNEGLAYAKDRKQFGKAIIDFPAVYDMLAIMKGKLDAGRALLYQTARYVDIYK
ALDDISRERKLTPEERLEQKKYAKLADSFTPLAKGMNSEYANQNAYDCIQIHGGSGFMME
YACQRIYRDARITSIYEGTTQLQTVAAIRYVTNGSYLATIREFETVPCSPEMEPLMSRLK
KMADLFEASTNAVKEAQDQELLDFTARRLMEMAADIIMCHLLIQDASKAADLFSKSAHVY
LNFAEAEVTKHTNFIKNMDKEDLAFYKK