Protein Info for BT1782 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative phosphoesterase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 38 to 55 (18 residues), see Phobius details PF01734: Patatin" amino acids 12 to 178 (167 residues), 99.9 bits, see alignment E=2.2e-32 PF19890: DUF6363" amino acids 213 to 277 (65 residues), 74.6 bits, see alignment E=4.5e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1782)

Predicted SEED Role

"Patatin-like phospholipase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A6U4 at UniProt or InterPro

Protein Sequence (281 amino acids)

>BT1782 putative phosphoesterase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKDLKLDEHTGLVLEGGGMRGVFTCGVLDYLMDHDIRFPYAIGVSAGACNGLSYASRQRG
RAKFSNIDLLEKYNYIGLKHLLRKRNILDFDLLFNEFPEHILPYDYDTYFASPERFVMVT
TNCMTGEANYFEEKRDKSRVIDIVRASSSLPFVCPVTYVDGVPMLDGGIVDSIPLQRAIA
DGYTRNVVILTRNRGYRKDTKDIRIPSFVYRKYPKLREALSRRCAVYNEQLEMVEQMEDE
GKIIVIRPQKPVMVDRIERDVQKLTEFYEEGYDCARNLFEF