Protein Info for BT1717 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative lipopolysaccharide biosynthesis protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 494 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 44 to 68 (25 residues), see Phobius details amino acids 80 to 103 (24 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 321 to 345 (25 residues), see Phobius details amino acids 365 to 395 (31 residues), see Phobius details amino acids 415 to 436 (22 residues), see Phobius details amino acids 443 to 463 (21 residues), see Phobius details PF01943: Polysacc_synt" amino acids 11 to 275 (265 residues), 120.5 bits, see alignment E=9.1e-39 PF13440: Polysacc_synt_3" amino acids 32 to 323 (292 residues), 325.1 bits, see alignment E=4e-101

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1717)

MetaCyc: 38% identical to Escherichia coli O:113 antigen repeat unit flippase (Escherichia coli O113)
7.5.99.a [EC: 7.5.99.a]

Predicted SEED Role

"Lipopolysaccharide biosynthesis protein WzxC" in subsystem Colanic acid biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.99.a

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A708 at UniProt or InterPro

Protein Sequence (494 amino acids)

>BT1717 putative lipopolysaccharide biosynthesis protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MENLKQKTVSGIMWSAIERFSLQGVQFIIQIILARLLLPSDYGMIGMLAIFLQVAQVFID
SGFTNALIQKKDRTEEDFATVFYFNILVAVLFYGILFFSASLIADFYNMPTLVLVIRFIA
LSLIINALSAIHRTKLIISVNFKTQSKISLGAAFISGVIGIWMAYVGCGVWALVWQTLLN
SIILTILFYCLVHWKPLHTFSKSSFERLFNFGSKLLISSLINTVYRNLYTIVIGKKFSVV
ELGYYTRAEQFAIFPSNNLNALVSRVAYPILSSIQDDDKCLTNAYRNYIRLSSYIIFPLM
VGLLVLANPIISLLLTDKWSGVVILLQILCLDWMFDHLSQINLNLLWVKGRSDLSLRLEI
IKKTIAIFILFVSIPFGLEVMCWGRVIYSLIATYLNTYYTNSLIDLTLKLQVKDVFPSLI
LSFIMGGIVFICISFFETDIVKIVIGCITGMSFYILLSFLFKLDSFFCILTLIIKTKNID
ENIKKDFSSNSKDN