Protein Info for BT1659 in Bacteroides thetaiotaomicron VPI-5482

Annotation: fructose-bisphosphate aldolase class I (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 PF01791: DeoC" amino acids 69 to 326 (258 residues), 212.8 bits, see alignment E=2.7e-67

Best Hits

Swiss-Prot: 66% identical to ALF1_ECOLI: Fructose-bisphosphate aldolase class 1 (fbaB) from Escherichia coli (strain K12)

KEGG orthology group: K01623, fructose-bisphosphate aldolase, class I [EC: 4.1.2.13] (inferred from 100% identity to bth:BT_1659)

MetaCyc: 66% identical to fructose-bisphosphate aldolase class I (Escherichia coli K-12 substr. MG1655)
Fructose-bisphosphate aldolase. [EC: 4.1.2.13]

Predicted SEED Role

"Fructose-bisphosphate aldolase class I (EC 4.1.2.13)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis (EC 4.1.2.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.13

Use Curated BLAST to search for 4.1.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A766 at UniProt or InterPro

Protein Sequence (350 amino acids)

>BT1659 fructose-bisphosphate aldolase class I (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MSKVVDLLGDKTSYYLDHTCKTIDKSLIYIPSPDTIDKVWIDSDRNIKVLNSLQTLLGHG
RLANTGYVSILPVDQDIEHTAGASFAPNPIYFDPENIVKLAIEGGCNAVASTFGILGSVA
RKYAHKIPFVVKLNHNELLTYPNTYDQVLFGTVKEAWNMGAVAVGATIYFGSEQSRRQLV
EIAEAFEYAHELGMATILWCYLRNSDFKKGAIDYHAAADLTGQADRLGVTIKADIVKQKL
PTNNGGFKAIGFGKTDERMYTELTSEHPIDLCRYQVANGYMGRVGLINSGGESHGASDLR
DAVITAVVNKRAGGMGLISGRKAFQKPMNKGVELLNAIQDVYLDPAITIA