Protein Info for BT1582 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative methyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 transmembrane" amino acids 29 to 46 (18 residues), see Phobius details amino acids 60 to 83 (24 residues), see Phobius details signal peptide" amino acids 47 to 47 (1 residues), see Phobius details PF13489: Methyltransf_23" amino acids 154 to 258 (105 residues), 35.5 bits, see alignment E=2e-12 PF13847: Methyltransf_31" amino acids 159 to 258 (100 residues), 29.9 bits, see alignment E=1.1e-10 PF13649: Methyltransf_25" amino acids 160 to 250 (91 residues), 38.3 bits, see alignment E=4.6e-13 PF08242: Methyltransf_12" amino acids 161 to 252 (92 residues), 34.2 bits, see alignment E=8.8e-12 PF08241: Methyltransf_11" amino acids 161 to 253 (93 residues), 43.3 bits, see alignment E=1.2e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1582)

Predicted SEED Role

"putative methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A7E2 at UniProt or InterPro

Protein Sequence (335 amino acids)

>BT1582 putative methyltransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MSVSSLFPNIRFHLRGSGTMLSTNISRFLRFRLHFLLLLGLIFLTFKDDSTHDCIFYTHI
YYIVSIHISDAKISLFYGIVYLWRIKQYIITKMATITLSAEKDPMGAAISDYFNHHRADR
LRVFSSQFEEDEIPVKELFRSIQSMPVLERTALQMATGRILDVGAGSGCHALALQEMGKE
VCAIDISPLSNEVMKQRGVKDSRLINLFDETFTETFDTVLMLMNGSGIIGTLNNMPAFFQ
RMKRILRPGGCILMDSSDLRYLFEEEDGSMLIDLAGDYYGEVDFQMQYKDVKGDTFDWLY
IDFQTLSLYASECGFKAELIKEGKHYDYLAKLSLA