Protein Info for BT1548 in Bacteroides thetaiotaomicron VPI-5482

Annotation: phosphoglucomutase phosphomannomutase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 51 to 190 (140 residues), 135.5 bits, E=2e-43
• PF02879: PGM_PMM_II
  • amino acids 214 to 319 (106 residues), 88.4 bits, E=8.4e-29
• PF02880: PGM_PMM_III
  • amino acids 328 to 451 (124 residues), 68.5 bits, E=1.2e-22
• PF00408: PGM_PMM_IV
  • amino acids 503 to 554 (52 residues), 27.5 bits, 5.4e-10

Best Hits

Swiss-Prot: 46% identical to PGCA_BACSU: Phosphoglucomutase (pgcA) from Bacillus subtilis (strain 168)

KEGG orthology group: K01840, phosphomannomutase [EC: 5.4.2.8] (inferred from 100% identity to bth:BT_1548)

MetaCyc: 46% identical to alpha-phosphoglucomutase (Bacillus subtilis)
Phosphoglucomutase. [EC: 5.4.2.2]

Predicted SEED Role

"Phosphoglucomutase (EC 5.4.2.2)" (EC 5.4.2.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (10/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• glycogen degradation I (7/8 steps found)
• GDP-mannose biosynthesis (4/4 steps found)
• β-1,4-D-mannosyl-N-acetyl-D-glucosamine degradation (3/3 steps found)
• D-galactose degradation I (Leloir pathway) (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (3/4 steps found)
• starch degradation III (3/4 steps found)
• starch degradation V (3/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• O-antigen building blocks biosynthesis (E. coli) (8/11 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• glycogen degradation II (4/6 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-glucose biosynthesis (1/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (6/9 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (3/5 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• sucrose degradation II (sucrose synthase) (3/5 steps found)
• sucrose biosynthesis II (5/8 steps found)
• superpathway of GDP-mannose-derived O-antigen building blocks biosynthesis (9/14 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• β-(1,4)-mannan degradation (3/7 steps found)
• starch biosynthesis (5/10 steps found)
• chitin biosynthesis (4/9 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (2/8 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (6/19 steps found)
• streptomycin biosynthesis (3/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (11/33 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Pentose phosphate pathway
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.8

Use Curated BLAST to search for 5.4.2.2 or 5.4.2.8

Sequence Analysis Tools

See Q8A7H6 at UniProt or InterPro

Protein Sequence (581 amino acids)

>BT1548 phosphoglucomutase phosphomannomutase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MENQELIKQVTEKAEKWLTPAYDAETQAEVKRMLENEDKTELIEAFYKDLEFGTGGLRGI
MGVGSNRMNIYTVGAATQGLSNYLKKNFKDLPQISVVVGHDCRNNSRLFAETSANIFSAN
GIKVYLFDDMRPTPEMSFAIRHLGCQSGIILTASHNPKEYNGYKAYWDDGAQVLAPHDAG
IIDEVNNIASAADIKFKGNPDLIQIIGEDIDKIYLDMVKTVSIDPEAIARHKDMKIVYTP
IHGTGMMLIPRALKMWGFENVFTVPEQMIKDGNFPTVISPNPENAEALSMAVNLAKEIDA
DLVMASDPDADRVGIACKDDKGEWVLINGNQTCMMYLYYILTQYKQLGKIKGNEFCVKTI
VTTELIKKIADKNNIEMLDCYTGFKWIAREIRLREGKKKYIGGGEESYGFLAEDFVRDKD
AVSACCLIAEVAAWAKDNGKSLYQLLLDIYVEYGFSKEFTVNVVKPGKSGAEEIKAMMEN
FRANPPKELGGSKVILSKDYKTLKQTDAEGKVTDLDMPETSNVLQYFTEDGSKVSVRPSG
TEPKIKFYMEVQGEMGCRNCFASADAAAMEKIEAVKKSLGI