Protein Info for BT1479 in Bacteroides thetaiotaomicron VPI-5482

Annotation: ABC transporter ATP-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 622 PF00005: ABC_tran" amino acids 22 to 181 (160 residues), 99 bits, see alignment E=1.1e-31 amino acids 329 to 464 (136 residues), 77.7 bits, see alignment E=4.1e-25 PF12848: ABC_tran_Xtn" amino acids 220 to 294 (75 residues), 40.3 bits, see alignment E=8.2e-14 PF16326: ABC_tran_CTD" amino acids 553 to 619 (67 residues), 66.4 bits, see alignment E=6.2e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1479)

Predicted SEED Role

"COG0488: ATPase components of ABC transporters with duplicated ATPase domains" in subsystem Folate Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A7P5 at UniProt or InterPro

Protein Sequence (622 amino acids)

>BT1479 ABC transporter ATP-binding protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MAVPYLQVDNLTKSFGDLVLFENISFGIAEGQRVGLIAKNGSGKTTLLNIIAGKEGYDSG
NIVFRRDLRVDYLEQDPQYPEELTVLEACFHHGNSTVELIKEYERCMETEGHPGLEDLLA
RMDQEKAWEYEQKAKQILSQLKIRNFDQRVKQLSGGQLKRVALANALITEPDLLILDEPT
NHLDLDMTEWLEDYLRRTNLSLLMVTHDRYFLDRVCSEIIEIDNQQIYQYKGNYSYYLEK
RQERIEAKSVEIERANNLYRTELDWMRRMPQARGHKARYREDAFYELEKVAKQRFNNDNV
KLEVKASYIGSKIFEADHLFKSYGDLKILDDFSYIFARYEKMGIVGNNGTGKSTFIKILM
GQVKPDSGTVDVGETVRFGYYSQDGLQFDEQMKVIDVVQDIAEVIELGNGKRLTASQFLQ
HFLFTPETQHSYVYKLSGGERRRLYLCTVLMRNPNFLVLDEPTNDLDIITLNVLEEYLQN
FKGCVIVVSHDRYFMDKVVDHLMVFNGQGDIRDFPGNYSDYRDWKEAKAQKEKEAEKPQE
EKTARVRLNDKRKMSFKEKREFEQLEKEIAELEAEKAQIEELLCSGMLSVDELTEKSKRL
PEVNDLIDEKTMRWLELSEIEG