Protein Info for BT1476 in Bacteroides thetaiotaomicron VPI-5482

Annotation: aspartate aminotransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 PF00155: Aminotran_1_2" amino acids 32 to 384 (353 residues), 180 bits, see alignment E=1.2e-56 PF00266: Aminotran_5" amino acids 85 to 203 (119 residues), 30.4 bits, see alignment E=3.2e-11 PF01041: DegT_DnrJ_EryC1" amino acids 89 to 202 (114 residues), 28.4 bits, see alignment E=1.5e-10

Best Hits

KEGG orthology group: K00811, aspartate aminotransferase [EC: 2.6.1.1] (inferred from 100% identity to bth:BT_1476)

Predicted SEED Role

"Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.1

Use Curated BLAST to search for 2.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A7P8 at UniProt or InterPro

Protein Sequence (399 amino acids)

>BT1476 aspartate aminotransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MPTISIRGNEMPASPIRKLAPLADAAKQRGVHVFHLNIGQPDLPTPQAAIDAIRNIDRKV
LEYSPSAGNRSYREKLVGYYAKFNINLTADDIIITSGGSEAVLFSFLSCLNPGDEIIVPE
PAYANYMAFAISAGAKIRTIATTIEEGFSLPKVEKFEELINERTKAILICNPNNPTGYLY
TRREMNQIRDLVKKYDLFLFSDEVYREFIYTGSPYISACHLEGIENNVVLIDSVSKRYSE
CGIRIGALITKNKEIRDAVMKFCQARLSPPLIGQIAAEASLDAPEEYSRETYDEYVERRK
CLIDGLNRIPGVYSPIPMGAFYTVAKLPVDDSDKFCAWCLSDFEYEGQTVFMAPASGFYT
TPGSGINEVRIAYVLKKEDLTRALFILQKALEVYPGRTE