Protein Info for BT1469 in Bacteroides thetaiotaomicron VPI-5482

Annotation: two-component system response regulator (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 PF00072: Response_reg" amino acids 6 to 120 (115 residues), 79.3 bits, see alignment E=1e-25 PF00158: Sigma54_activat" amino acids 153 to 319 (167 residues), 222.3 bits, see alignment E=1.3e-69 PF14532: Sigma54_activ_2" amino acids 154 to 324 (171 residues), 64.9 bits, see alignment E=3.8e-21 PF07728: AAA_5" amino acids 176 to 295 (120 residues), 29.3 bits, see alignment E=3.2e-10 PF00004: AAA" amino acids 177 to 315 (139 residues), 22.1 bits, see alignment E=7.4e-08 PF02954: HTH_8" amino acids 411 to 451 (41 residues), 55.7 bits, see alignment 1.4e-18 PF13556: HTH_30" amino acids 422 to 452 (31 residues), 28.3 bits, see alignment (E = 5.1e-10)

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1469)

Predicted SEED Role

"Two-component system response regulator" in subsystem Streptococcal Mga Regulon or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A7Q5 at UniProt or InterPro

Protein Sequence (453 amino acids)

>BT1469 two-component system response regulator (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MENGTILIVDDNKSVLASLELLLENEFGTVRTAANPNQITTLLTTTSIDVVILDMNFSAG
INNGNEGLYWLKQIHEIRPSLPVVMLTAYGDVELAVKALKNGATDFLLKPWDNQILIRKI
KEAYKSNNSKAKSASKATGKQGDTEKPSKPEMLIGHSPAMLQLIKVVTKVAKTDANILIT
GENGTGKEMLAKEIHRLSPRNSRQMLGIDMGAISESLFESELFGHERGAFTDAYESRPGK
FEAANGSSLFMDEIGNLSIALQAKLLTVLQNRNVTRIGSNKVIPVDIRLISATNKDIPEM
VKQGLFREDLFYRINTIHLEIPPLRERGDDILLFIDTFLRRFTSKYQRPDIRMHEQTIEK
LRSYHWPGNIRELQHAIEKAVILCEGNVIRPKDILVKQSWKPQTASVVPNLEEVERQAIE
TAILQNNGNLTAAAEQLGISRQTLYNKLKRFKP