Protein Info for BT1380 in Bacteroides thetaiotaomicron VPI-5482

Annotation: imidazole glycerol phosphate synthase subunit hisH (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 TIGR01855: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit" amino acids 3 to 195 (193 residues), 209.7 bits, see alignment E=1.9e-66 PF00117: GATase" amino acids 11 to 194 (184 residues), 79.8 bits, see alignment E=3.4e-26 PF01174: SNO" amino acids 11 to 104 (94 residues), 41 bits, see alignment E=3e-14 PF07685: GATase_3" amino acids 20 to 103 (84 residues), 29.7 bits, see alignment E=7.4e-11

Best Hits

Swiss-Prot: 100% identical to HIS5_BACTN: Imidazole glycerol phosphate synthase subunit HisH (hisH) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02501, glutamine amidotransferase [EC: 2.4.2.-] (inferred from 100% identity to bth:BT_1380)

MetaCyc: 43% identical to imidazole glycerol phosphate synthase subunit HisH (Escherichia coli K-12 substr. MG1655)
GLUTAMIDOTRANS-RXN [EC: 4.3.2.10]

Predicted SEED Role

"Imidazole glycerol phosphate synthase amidotransferase subunit (EC 2.4.2.-)" in subsystem Histidine Biosynthesis (EC 2.4.2.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.- or 4.3.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A7Z4 at UniProt or InterPro

Protein Sequence (196 amino acids)

>BT1380 imidazole glycerol phosphate synthase subunit hisH (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKVAVVKYNAGNIRSVDYALKRLGVEAVITADKEILQSADKVIFPGVGEAGTTMNHLKAT
GLDELIKNLRQPVFGICLGMQLMCRHSEEGEVDCLNIFDVDVKRFVPQKHEDKVPHMGWN
TIGKTNSKLFEGFTEEEFVYFVHSFYVPVCDFTAAETDYIHPFSAALHKDNFYATQFHPE
KSGKTGERVLRNFLDL