Protein Info for BT1343 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative capsule biosynthesis protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 29 to 47 (19 residues), see Phobius details amino acids 72 to 98 (27 residues), see Phobius details amino acids 108 to 125 (18 residues), see Phobius details amino acids 153 to 180 (28 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 265 to 285 (21 residues), see Phobius details amino acids 291 to 313 (23 residues), see Phobius details amino acids 320 to 339 (20 residues), see Phobius details PF14897: EpsG" amino acids 30 to 352 (323 residues), 215.6 bits, see alignment E=5.2e-68

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1343)

Predicted SEED Role

"putative capsule biosynthesis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A831 at UniProt or InterPro

Protein Sequence (355 amino acids)

>BT1343 putative capsule biosynthesis protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MTIFYYSFIILALLACLTVSFRIKKQQYLILYLFVIVLLSLLAGLRYDNADYENYLEIFK
NPWEVSPDKGFSAFVLIVRWFTTSPIYMFLPVAIIAVSLNISSYRKYSPYLFVSVLFYFV
HSFLLKEYVQIRAGLSCAICLYAIRYIEYKSLWKYIACMVIAMSIHMSSIIFFPMFWVYY
FMKNKSNSCLMYFLLLSFIIGTLYPFGQVIKAYVPFLDETSRIATYANWDQFNNEIGILT
NFTTLKQIILCVLCYIYWTRLKEVISCFSVLYLAYVLSTCWLMLFNDFVIIGARMATFLS
VGEPIFFAGFLCLFNKQSRILVTLFFIIISCIIMDVNLHTKNLGEFKLYPLTSLF