Protein Info for BT1327 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative alkaline phosphatase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 53 to 75 (23 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details PF09335: SNARE_assoc" amino acids 47 to 164 (118 residues), 79.2 bits, see alignment E=1.9e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1327)

Predicted SEED Role

"Alkaline phosphatase like protein" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A847 at UniProt or InterPro

Protein Sequence (212 amino acids)

>BT1327 putative alkaline phosphatase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MESVAFIQWCLEHLNYWTITLLMTIESSFIPFPSEVIIPPAAYKAAVNDELNIYLVVLFA
TIGADIGALINYYLAKWLGRPIIYKFANSRIGHMCLIDEAKVQHAESYFDKHGALSTFIG
RLIPAVRQLISIPAGLARMKMHTFLLYTTIGAGLWNTILAVIGYYLSTVPGIESEEQLIA
KVTEYSHEIGYCFIAIGIFIVGFLVYKGMKKK