Protein Info for BT1298 in Bacteroides thetaiotaomicron VPI-5482

Annotation: V-type ATP synthase subunit B (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 PF02874: ATP-synt_ab_N" amino acids 37 to 72 (36 residues), 26.8 bits, see alignment 6e-10 PF00006: ATP-synt_ab" amino acids 128 to 337 (210 residues), 167.9 bits, see alignment E=2.6e-53

Best Hits

Swiss-Prot: 47% identical to VATB1_TREPA: V-type ATP synthase beta chain 1 (atpB1) from Treponema pallidum (strain Nichols)

KEGG orthology group: K02118, V-type H+-transporting ATPase subunit B [EC: 3.6.3.14] (inferred from 100% identity to bth:BT_1298)

Predicted SEED Role

"V-type ATP synthase subunit B (EC 3.6.3.14)" in subsystem V-Type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A876 at UniProt or InterPro

Protein Sequence (441 amino acids)

>BT1298 V-type ATP synthase subunit B (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MATKAFQKIYTKITQITKATCSLKATGVGYDELATVNGKLAQVVKIAGDDVTLQVFEGTE
GIPTNAEVVFLGKSPTLKVSEQLAGRFFNAFGDPIDGGPEIEGQEVEIGGPSVNPVRRKQ
PSELIATGIAGIDLNNTLVSGQKIPFFADPDQPFNQVMANVALRAETDKIILGGMGMTND
DYLYFKNVFSNAGALDRIVSFMNTTENPPVERLLIPDMALTAAEYFAVNNNEKVLVLLTD
MTSYADALAIVSNRMDQIPSKDSMPGSLYSDLAKIYEKAVQFPSGGSITIIAVTTLSGGD
ITHAVPDNTGYITEGQLFLRRDSDIGKVIVDPFRSLSRLKQLVTGKKTRKDHPQVMNAAV
RLYADAANAKTKMENGFDLTNYDERTLAFAKDYSNQLLAIDVNLDTTEMLDVAWGLFGEY
FRPEEVNIKKELVDQYWPKGE