Protein Info for BT1244 in Bacteroides thetaiotaomicron VPI-5482

Annotation: chaperone protein dnaJ (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 TIGR02349: chaperone protein DnaJ" amino acids 6 to 373 (368 residues), 428 bits, see alignment E=1.7e-132 PF00226: DnaJ" amino acids 6 to 68 (63 residues), 96.1 bits, see alignment E=1.6e-31 PF01556: DnaJ_C" amino acids 140 to 357 (218 residues), 150.5 bits, see alignment E=5.8e-48 PF00684: DnaJ_CXXCXGXG" amino acids 167 to 231 (65 residues), 59.5 bits, see alignment E=4.7e-20

Best Hits

Swiss-Prot: 100% identical to DNAJ_BACTN: Chaperone protein DnaJ (dnaJ) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 100% identity to bth:BT_1244)

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A8C3 at UniProt or InterPro

Protein Sequence (396 amino acids)

>BT1244 chaperone protein dnaJ (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MAEKRDYYEVLEVTKTATVEEIKKAYRKKAIQYHPDKNPGDKEAEEKFKEAAEAYDVLSN
PDKRSRYDQFGHAGVSGAAGNGGPFGGFGGEGMSMDDIFSMFGDIFGGRGGGFSGGFGGF
SGFGGGGGGSQQRRYRGSDLRVKVKMTLKEISTGVEKKFKLKKYVPCNHCHGTGAEGDGG
SETCPTCKGSGSVIRNQQTILGTMQTRTTCPTCNGEGKIIKNKCKECGGDGIVYGEEVVT
VKIPAGVAEGMQLSMGGKGNAGKHNGVPGDLLILVEEEPHPDLIRDENDLIYNLLLSFPT
AALGGAVEIPTIDGKVKVKIDSGTQPGKVLRLRGKGLPNVNGYGTGDLLVNISIYVPEAL
NKEEKSTLEKMEASDNFKPSTSVKEKIFKKFKSFFD