Protein Info for BT1209 in Bacteroides thetaiotaomicron VPI-5482

Annotation: cytochrome D ubiquinol oxidase subunit II (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 56 to 76 (21 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 253 to 278 (26 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 341 to 360 (20 residues), see Phobius details PF02322: Cyt_bd_oxida_II" amino acids 5 to 362 (358 residues), 232.7 bits, see alignment E=3.4e-73

Best Hits

KEGG orthology group: K00426, cytochrome bd-I oxidase subunit II [EC: 1.10.3.-] (inferred from 100% identity to bth:BT_1209)

Predicted SEED Role

"Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A8F8 at UniProt or InterPro

Protein Sequence (380 amino acids)

>BT1209 cytochrome D ubiquinol oxidase subunit II (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MYIFLQQYWWLVVSLLGAILVFLLFVQGGNSLLFCLGKTEEHRKMMVNSTGRKWEFTFTT
LVTFGGAFFASFPLFYSTSFGGAYWLWMIILFSFVLQAVSYEFQSKAGNLLGKKTYQTFL
VINGVVGPLLLGGAVATFFTGSDFYINKANMTDTIMPVISHWGNGWHGLDALTNIWNVIL
GLAVFFLARVLGSLYFINSIADKELTDKCRRAVLNNTIFFLVFFLVFVIRTLVSDGFAVN
PDTLEVYMQPYKYFINFIEMPVVLIIFLIGVVLVLFGIGKTVLKKTFDKGIWFAGIGTVL
TVLALLLVAGYNNTAYYPSYTDLQSSLTLANSCSSEFTLKTMAYVSILVPFVIAYIFYAW
RSIDRHKITEKEMDEGGHSY