Protein Info for BT1165 in Bacteroides thetaiotaomicron VPI-5482

Annotation: hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 34 to 51 (18 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 87 to 105 (19 residues), see Phobius details amino acids 111 to 135 (25 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 227 to 256 (30 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 360 to 385 (26 residues), see Phobius details amino acids 396 to 414 (19 residues), see Phobius details amino acids 420 to 439 (20 residues), see Phobius details PF04932: Wzy_C" amino acids 232 to 371 (140 residues), 49.8 bits, see alignment E=1.7e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_1165)

Predicted SEED Role

"Putative secreted polysaccharide polymerase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A8K2 at UniProt or InterPro

Protein Sequence (455 amino acids)

>BT1165 hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MFFRTSLPFFLTISSLPLMTVIFLLIIKYSKQSFYTLFILQFLLAAAYAVTDIPLGVATL
MCTLFAVVLLFAYGMHEKIDWSESRNGMLMLFLIWGVYCILEIANPNNVQAAWNISITHY
LIYPIVCAVIVPLAIRNIKGIQWLLIIWSLFILLAAAKGYWQKNCGFNEREQYFLYVLGG
ARTHIIWSGIRYFSFFSDAANFGVHMAMGVSLFGISLFYIKGVWLKIYFIIVIIAAIYGM
GISGTRAAIALPIGALGSFIILSRNRKACITGISVLALLFLFFVCTNIGDDNQYIRKMRS
AFRPSQDASYQLRVDNRKKMRELMIHKPFGYGIGLSKGDRFYPKERMLYPPDSWLVSVWV
ETGIIGLVLYLAVHGVLFAWCGWILMFKIMNKRLRGLLTAWLCTAAGFYLAAYANDVMQY
PNSIPIYTAFALCFAGPYIDKRMQQSKETELKNEQ