Protein Info for BT1156 in Bacteroides thetaiotaomicron VPI-5482

Annotation: Na+-translocating NADH-quinone reductase subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 105 to 129 (25 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details TIGR01940: NADH:ubiquinone oxidoreductase, Na(+)-translocating, E subunit" amino acids 2 to 206 (205 residues), 289.8 bits, see alignment E=8e-91 PF02508: Rnf-Nqr" amino acids 5 to 206 (202 residues), 177.3 bits, see alignment E=1.4e-56

Best Hits

KEGG orthology group: K00350, Na+-transporting NADH:ubiquinone oxidoreductase subunit E [EC: 1.6.5.-] (inferred from 100% identity to bth:BT_1156)

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit E (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A8L1 at UniProt or InterPro

Protein Sequence (208 amino acids)

>BT1156 Na+-translocating NADH-quinone reductase subunit (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MEHLLSLFVRSIFVDNMIFAFFLGMCSYLAVSKNVKTAVGLGIAVTFVLLVTLPVNYLLQ
TKVLAANAIIEGVDLSFLSFILFIAVIAGIVQLVEMVVERFSPSLYASLGIFLPLIAVNC
AIMGASLFMQQRINLGASDPKYIGDVWDALSYALGSGIGWLLAIVGLAAIREKMAYSDVP
APLKGLGITFITVGLMAIAFMCFSGLNI