Protein Info for BT1099 in Bacteroides thetaiotaomicron VPI-5482
Annotation: putative arginase (NCBI ptt file)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 99% identity to bvu:BVU_3509)Predicted SEED Role
"Arginase (EC 3.5.3.1)" in subsystem Arginine and Ornithine Degradation (EC 3.5.3.1)
MetaCyc Pathways
- urea cycle (4/5 steps found)
- L-arginine degradation VI (arginase 2 pathway) (3/4 steps found)
- L-arginine degradation VII (arginase 3 pathway) (1/2 steps found)
- L-canavanine degradation I (1/2 steps found)
- putrescine biosynthesis III (1/2 steps found)
- superpathway of L-citrulline metabolism (8/12 steps found)
- L-citrulline biosynthesis (5/8 steps found)
- superpathway of putrescine biosynthesis (2/4 steps found)
- L-Nδ-acetylornithine biosynthesis (4/7 steps found)
- L-arginine degradation I (arginase pathway) (1/3 steps found)
- superpathway of polyamine biosynthesis II (4/8 steps found)
- superpathway of arginine and polyamine biosynthesis (10/17 steps found)
- superpathway of polyamine biosynthesis I (2/8 steps found)
- superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (3/16 steps found)
KEGG Metabolic Maps
- Arginine and proline metabolism
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Urea cycle and metabolism of amino groups
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.5.3.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8A8R8 at UniProt or InterPro
Protein Sequence (269 amino acids)
>BT1099 putative arginase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482) MQKQRMSGQNQKTDKRIAWPIIIMNFTGVYDYEAFARNNKFIWLDCRHLYGTDGYCDREG ALALKGMIADYPAEGVHFIDSGNYHYLTKFWTDKLETPFSLIVFDHHPDMQPPLFDNILS CGSWVKDILDHNNNCKKVIIVGSSDKLIQAVPKGYERQVRFYSETTLMHEEGWQNFSSGH INGPVYISIDKDVLNPASAATNWDQGSLSLWELEKLLAVILQKEQVVGIDICGECSTTLN LFEEKRETVMDSQANKELLRFIRSSSGLQ