Protein Info for BT0988 in Bacteroides thetaiotaomicron VPI-5482

Annotation: Mg2+ transport ATPase protein B (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 883 transmembrane" amino acids 69 to 92 (24 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 299 to 323 (25 residues), see Phobius details amino acids 690 to 708 (19 residues), see Phobius details amino acids 712 to 731 (20 residues), see Phobius details amino acids 752 to 775 (24 residues), see Phobius details amino acids 787 to 805 (19 residues), see Phobius details amino acids 817 to 840 (24 residues), see Phobius details amino acids 853 to 871 (19 residues), see Phobius details TIGR01524: magnesium-translocating P-type ATPase" amino acids 16 to 882 (867 residues), 1268.7 bits, see alignment E=0 PF00690: Cation_ATPase_N" amino acids 27 to 89 (63 residues), 45.4 bits, see alignment 1.3e-15 TIGR01494: HAD ATPase, P-type, family IC" amino acids 110 to 211 (102 residues), 67.4 bits, see alignment E=8.4e-23 amino acids 240 to 374 (135 residues), 72.5 bits, see alignment E=2.5e-24 amino acids 588 to 712 (125 residues), 97.7 bits, see alignment E=5.7e-32 PF00122: E1-E2_ATPase" amino acids 141 to 333 (193 residues), 140.4 bits, see alignment E=1.2e-44 PF13246: Cation_ATPase" amino acids 400 to 464 (65 residues), 46 bits, see alignment 1.1e-15 PF00702: Hydrolase" amino acids 470 to 636 (167 residues), 47.7 bits, see alignment E=6.5e-16 PF00689: Cation_ATPase_C" amino acids 706 to 873 (168 residues), 75.8 bits, see alignment E=9.6e-25

Best Hits

KEGG orthology group: K01531, Mg2+-importing ATPase [EC: 3.6.3.2] (inferred from 100% identity to bth:BT_0988)

Predicted SEED Role

"Mg(2+) transport ATPase, P-type (EC 3.6.3.2)" (EC 3.6.3.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A929 at UniProt or InterPro

Protein Sequence (883 amino acids)

>BT0988 Mg2+ transport ATPase protein B (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MVWKKKLRSSQYTFNSERVFLVATQPGKSIYSCLQTTKLGLTLGEVQERQSIYGRNEVIH
EQKKNPFILFIRTFINPFIGVLTGLAIISLFLDVLMAEPGEQEWTGVIIISSMVLFSAVL
RFWQEWRASEATDSLMRMVKNTCLAKRAGEQEEEIDITELVPGDIVYLAAGDMVPADIHI
IDSKDLFISQASLTGESEPIEKFPEVQGQQFRKGSVIELDNICYMGSNVISGAAKGIVFE
TGNKTYLGTIAKSLVGHRATTAFDKGISKVSFLLIRFMLVMVPFVFFVNGFTKGDWFEAF
IFAVSVAVGLTPEMLPMIVTANLSKGAIAMSKKKTIVKNLNAIQNFGAMDILCTDKTGTL
TCDKIVLEKYINADGSDDNSKRILRHAYFNSYFQTGLRNLMDKAILSHVRELNLEHLKDA
YTKVDEIPFDFTRRRMSVVIEDRQGKRQIITKGAVEEILDVCSYAEFDREIHPLTDSLKI
KAQKISEEMNRQGMRVLAVSQKSFIEKDCNFAIEDEKEMVLIGYLAFLDPPKPSAAEAIE
QLYMHGVAVKILSGDNDTVVKAIARQVGIDTGHSLTGIEMEEMDETTLKETVKDTTLFSK
LTPLQKTQIISLLQEQGNTVGFLGDGINDAGALRQSDIGISVDSAVDIAKESADIILLEK
DLMVLEDGVLEGRKTFGNINKYIKMTASSNFGNMFSVMFASAFLPFLPMMPIHLLIQNLL
YDISQTTIPFDRMDPEFLKKPRKWDASDLSRFMIYIGPISSIFDIATYLVMWYVFSCNSP
EHQTLFQTGWFVEGLLSQTLIVHMIRTRKIPFIQSRATWPVMGLTFLIMAVGILIPFTAF
GRSIGLTALPLGYFPWLIGILLSYCILTQLVKNWYIRKFVRWL