Protein Info for BT0957 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 166 to 177 (12 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details amino acids 335 to 354 (20 residues), see Phobius details amino acids 366 to 384 (19 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 28 to 382 (355 residues), 175.7 bits, see alignment E=7.7e-56

Best Hits

KEGG orthology group: K01992, ABC-2 type transport system permease protein (inferred from 100% identity to bth:BT_0957)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A960 at UniProt or InterPro

Protein Sequence (389 amino acids)

>BT0957 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKKLNKLQQLSFIIRREYLAISTSYAVLLVLMGGIFVYGLLYNYMYAPNIVTDVPVAVVD
NSHSELSRNFIRWLDATPQAEIYDQAMDYHEAKEWMKAGKVQGILYLPHDFEERVFRGDE
AVFSLYATTDAFLYFEALQGASSRVMLAINDKYRPDGAVFLPPQGLLAVAMAQPVNIAGT
ALYNYTEGYGSYLIPAVMVIIIFQTLLMVIGMVTGEEHMTKGILAYTPFGKSWAVAIRIV
SGKTFVYCSLYAVFSFFLLGLLPHFFSIPNIGNGLYIVLMMIPYLLATSFLGLAASRYFT
DSEAPLLMIAFFSVGLIFLSGVSYPMELMPWYWKAAHYIFPAAPATLAFVKLNSMGASMA
DIRPEYITLWIQAVIYFILSAWVYKKKLS