Protein Info for BT0875 in Bacteroides thetaiotaomicron VPI-5482

Annotation: beta-ureidopropionase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF00795: CN_hydrolase" amino acids 5 to 272 (268 residues), 208.2 bits, see alignment E=6.9e-66

Best Hits

Swiss-Prot: 41% identical to AGUB_SOLLC: N-carbamoylputrescine amidase (CPA) from Solanum lycopersicum

KEGG orthology group: K12251, N-carbamoylputrescine amidase [EC: 3.5.1.53] (inferred from 100% identity to bth:BT_0875)

MetaCyc: 40% identical to At2g27450-monomer (Arabidopsis thaliana col)
N-carbamoylputrescine amidase. [EC: 3.5.1.53]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.53

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A9E0 at UniProt or InterPro

Protein Sequence (294 amino acids)

>BT0875 beta-ureidopropionase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKKIKVGLIQQSNTADIRVNLMNLAKSIEACAAHGAQLIVLQELHNSLYFCQTENTNLFD
LAEPIPGPSTGFYSELAAANKVVLVASLFEKRAPGLYHNTAVVFDRDGSIAGKYRKMHIP
DDPAYYEKFYFTPGDIGFEPIQTSLGKLGVLVCWDQWYPEAARLMALKGAELLIYPTAIG
WESSDTDDEKARQLNAWIISQRAHAVANGLPVISVNRVGHEPDPSGQTNGIQFWGNSFVA
GPQGEFLAQASNDHPENMVVEIDMERSENVRRWWPFLRDRRIDEYDGLTKRFLD