Protein Info for BT0864 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative permease (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 785 transmembrane" amino acids 24 to 48 (25 residues), see Phobius details amino acids 274 to 296 (23 residues), see Phobius details amino acids 331 to 356 (26 residues), see Phobius details amino acids 367 to 390 (24 residues), see Phobius details amino acids 414 to 436 (23 residues), see Phobius details amino acids 663 to 686 (24 residues), see Phobius details amino acids 714 to 732 (19 residues), see Phobius details amino acids 748 to 770 (23 residues), see Phobius details PF02687: FtsX" amino acids 283 to 398 (116 residues), 27.4 bits, see alignment E=1.5e-10 amino acids 666 to 774 (109 residues), 44.7 bits, see alignment E=6.3e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0864)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A9F1 at UniProt or InterPro

Protein Sequence (785 amino acids)

>BT0864 putative permease (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MERTAMENLVLLKLIFRNWWRNKLFAVISLVSLVVGISCTNLLISFVIHEYTIEGENPKK
DRILRLTQRLPSMQSTGQVSFVYGGSVAGMIAPFPEIESYLRLTEKEATHIEIENQRFPQ
QVIVEADSSFCRFFPYQILSGNMKEALTKPDCIALSEEKAMQYFGKFDCIGRELSVVYGD
KVEMKKVSAIYKFYAQSALRIDLLGNSQNLQEEGTSCMILLKEKTDVSAFRERFESTELP
TVTGPGYYKLQTLQESYFDTKLADSVKTFSHRQIALLSIGLLSAFLVLFIACFNYVNLSF
SRLLKQVNMIHVETLMGASHSYICRQLFIDTFLTVFIAFILSILVMGDILSLFNYFFDAR
LTFGFILSWKVFPFILLFVSLLAIIPATYMTKKLNRISISGYRQFFQGRKRRRLVATLVG
VQMVISIGLMTAFMMIRTQLSTIEGQGERFKGVIILGNEGAALTIPLYNDIKNLPGIQTA
LLSKGRITSPFNIIIPLNRNGQEVMVNKVLLTENYGLLDLFNIELLEPERTEDLFSKVAH
PVVVNEAFVQFFVPGGEDPVGQTLSKYEQDNAGEGTIIGVCKDFRLTSFNSAITPMQIIL
QEIPVDQATYLSCRIDEGRRNEIVKNLRLLWEKHEPGHSFVYIDAYQQYISNNTDMVNFS
RLLLAYAIISLFLTLFGIFGITWYAVEQRKREIAIRKVHGASSRQILLLLNRPFFYYILI
ADMIAIPIVYVLMKRWREQFVYPTDWGIEVFIVPVVLLMLVTFVTVVLNGYHTALSNPAE
TIKTE