Protein Info for BT0853 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative methyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF01209: Ubie_methyltran" amino acids 28 to 146 (119 residues), 24.3 bits, see alignment E=8.5e-09 PF08003: Methyltransf_9" amino acids 36 to 147 (112 residues), 36.2 bits, see alignment E=1.6e-12 PF05175: MTS" amino acids 39 to 146 (108 residues), 26.5 bits, see alignment E=2e-09 PF13489: Methyltransf_23" amino acids 39 to 177 (139 residues), 53.2 bits, see alignment E=1.4e-17 PF06325: PrmA" amino acids 48 to 148 (101 residues), 24.1 bits, see alignment E=1.1e-08 PF13847: Methyltransf_31" amino acids 49 to 148 (100 residues), 51 bits, see alignment E=6.3e-17 PF13649: Methyltransf_25" amino acids 52 to 143 (92 residues), 66.8 bits, see alignment E=1.1e-21 PF08241: Methyltransf_11" amino acids 53 to 147 (95 residues), 65.1 bits, see alignment E=3.4e-21 PF08242: Methyltransf_12" amino acids 53 to 144 (92 residues), 43.3 bits, see alignment E=2.3e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0853)

Predicted SEED Role

"Ubiquinone/menaquinone biosynthesis methyltransferase UBIE (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A9G2 at UniProt or InterPro

Protein Sequence (251 amino acids)

>BT0853 putative methyltransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNLIEVMKENKYDDDRFFSQYAQMSRSVEGLQGAGEWHILQKMLPDFTDKRVLDLGCGFG
WHCIYAIEHGAKCVTGIDISGKMLEEAQKRNSSPLIEYKCMAIEDFDFQPDTYDIVISSL
TFHYLESFINICRKVNSCLTAGGSFVFSVEHPIFTAYGNQDWYYDQDGKRAHWPVDRYFS
EGKRTAIFLGEEVVKYHKTLTTYINSLLQTGFEICELIEPQPSEMMLDTIPEMQDELRRP
MMLLISAKKKS