Protein Info for BT0718 in Bacteroides thetaiotaomicron VPI-5482

Annotation: ATP synthase alpha chain (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 TIGR00962: ATP synthase F1, alpha subunit" amino acids 5 to 525 (521 residues), 752.6 bits, see alignment E=1e-230 PF02874: ATP-synt_ab_N" amino acids 29 to 93 (65 residues), 55.3 bits, see alignment E=1.2e-18 PF00006: ATP-synt_ab" amino acids 152 to 390 (239 residues), 261.3 bits, see alignment E=1e-81 PF00306: ATP-synt_ab_C" amino acids 397 to 519 (123 residues), 137.5 bits, see alignment E=4.9e-44

Best Hits

Swiss-Prot: 100% identical to ATPA_BACTN: ATP synthase subunit alpha (atpA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02111, F-type H+-transporting ATPase subunit alpha [EC: 3.6.3.14] (inferred from 100% identity to bth:BT_0718)

Predicted SEED Role

"ATP synthase alpha chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A9U7 at UniProt or InterPro

Protein Sequence (527 amino acids)

>BT0718 ATP synthase alpha chain (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MSENIRVSEVSDILRKQLEGINTNVQLDEIGTVLQVSDGVVRIYGLRNAEANELLEFDNG
IKAIVMNLEEDNVGAVLLGPTDRIKEGFIVKRTKRIASIRVGESMLGRVIDPLGEPLDGK
GLIGGELYEMPLERKAPGVIYRQPVNQPLQTGLKAVDAMIPIGRGQRELIIGDRQTGKTS
IAIDTIINQRNNFLAGDPVYCIYVAIGQKGSTVASIVNTLREYGAMDYTIVVAATAGDPA
ALQYYAPFAGAAIGEYFRDTGRHALVVYDDLSKQAVAYREVSLILRRPSGREAYPGDIFY
LHSRLLERAAKIIKEEEVAREMNDLPESLKGIVKVGGSLTALPIIETQAGDVSAYIPTNV
ISITDGQIFLETDLFNQGVRPAINVGISVSRVGGNAQIKAMKKVAGTLKMDQAQYRELEA
FSKFSSDMDPITAMTIDKGRKNAQLLIQPQYSPMPVEQQIAILYCGTHGLLHDVPLENVQ
DFERSFIESLQLNHQEDVLDVLRTGVIDDNVTKAIEETAAMVAKQYL