Protein Info for BT0674 in Bacteroides thetaiotaomicron VPI-5482

Annotation: carboxynorspermidine decarboxylase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 TIGR01047: carboxynorspermidine decarboxylase" amino acids 8 to 377 (370 residues), 493.4 bits, see alignment E=1.5e-152 PF00278: Orn_DAP_Arg_deC" amino acids 134 to 335 (202 residues), 44.9 bits, see alignment E=5.9e-16

Best Hits

KEGG orthology group: K13747, carboxynorspermidine decarboxylase [EC: 4.1.1.-] (inferred from 100% identity to bth:BT_0674)

Predicted SEED Role

"Carboxynorspermidine decarboxylase, putative (EC 4.1.1.-)" in subsystem Polyamine Metabolism (EC 4.1.1.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A9Z1 at UniProt or InterPro

Protein Sequence (379 amino acids)

>BT0674 carboxynorspermidine decarboxylase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MIDFTQFPSPCYIMEEELLRKNLCLIKSVADRAGVEIILAFKSFAMWRSFPIFREYVEHS
TASSVYEARLALEEFGSKAHTYSPAYTEQDFPEIMRCSSHITFNSMAQFRRFYPMTVAEG
SGISCGIRVNPEYSEVETELYNPCAPGTRFGMTADLLPDTLPKGIEGFHCHCHCESSSFE
LERTLQHLEEKYSRWFPQIKWLNLGGGHLMTRKDYDTEHLIKLLQDLKARYPHLQIILEP
GSAFTWQTGVLTSEVVDIVESRGIKTAILNVSFTCHMPDCLEMPYQPAVRGAEMGNEGEF
IYRLGGNSCLSGDYMGLWSFDHELQIGERIVFEDMIHYTMVKTNMFNGIHHPAIALWTKE
GKAEIYKQFSYEDYRDRMS