Protein Info for BT0662 in Bacteroides thetaiotaomicron VPI-5482

Annotation: hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 598 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 36 to 58 (23 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 164 to 181 (18 residues), see Phobius details amino acids 188 to 204 (17 residues), see Phobius details amino acids 210 to 228 (19 residues), see Phobius details amino acids 239 to 262 (24 residues), see Phobius details amino acids 330 to 353 (24 residues), see Phobius details amino acids 361 to 379 (19 residues), see Phobius details amino acids 385 to 404 (20 residues), see Phobius details amino acids 414 to 434 (21 residues), see Phobius details PF04932: Wzy_C" amino acids 193 to 346 (154 residues), 84.7 bits, see alignment E=1.2e-27 PF12895: ANAPC3" amino acids 453 to 532 (80 residues), 29.2 bits, see alignment E=1.9e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0662)

Predicted SEED Role

"FIG00896341: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AA03 at UniProt or InterPro

Protein Sequence (598 amino acids)

>BT0662 hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MMENRKCVILSIGVTLAICGMLCSSFWGRYSMFDNYFLLFPVSLGICLVTITAILSFLTK
KKIFQLSVADVLISILVVYYIVRYDYELQLANWKIMYAILLLILWYALRILLMNATISRP
ILFGGIVAIGCMLSIWGLLQLYGLQPSNHRLFAITGPFYNPGPYSGYLAMIFPINLGCLL
QSMGKTRYLWLVAFALMLCILPAGMSRSAWLALSFSSLWVLVIHFKWITKAKSYLQTHFY
TATLLYITVAIIIVCASVLLYQMKADSANGRLFIWKTTCKVIANKPLLGYGPGTFSHVYG
EMQSTYFASEKYTEQEERVAGAPEYAFNELLQLCVEGGIILLMLFLMLIVWVVGKGISNK
DYIACSGLISLLLFSLSSYPFQVLPFLMMGVLLLVVCVTNPKGIIEKNACIPRICTLLLL
ISMLAGNILCLYKLCNVNELSQRLYYIKVLQDQSLQKEASTGYGRLYDFFKHNFNYLMKY
AGNLFAQKRYDEAIVILERAKLVSCHPSIYTLQGQCYQALGNFADAEKCYKAAALLLPIR
IYPYYLLAKLYAEPDFYHETKMKQMINIVLTKEPKVYSKAIHEMRMEMNILLNNRITN