Protein Info for BT0633 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative Na+/H+ exchange protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 46 (20 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 130 to 149 (20 residues), see Phobius details amino acids 155 to 172 (18 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 214 to 231 (18 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 321 to 343 (23 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0633)

Predicted SEED Role

"putative Na+/H+ exchange protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AA32 at UniProt or InterPro

Protein Sequence (381 amino acids)

>BT0633 putative Na+/H+ exchange protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MLGLVISQFLPMIAGEGYGTVKVLSNILLYVCLSFIMINVGREFVLDKVRWKSYAEDYLI
AMATAALPWFMIAIYYVFVLLPPDYWNSWEAWKENLLLSRFAAPTSAGILFTMLAAIGLK
SSWIYKKIQVLAIFDDLDTILLMIPLQIMMIGLRWQLIIVVVIVFMLLSIGWKQLNKYNW
RQDWKAILFYSVIIFLATQILYLGSKELYGEEGSIHIEVLLPAFVLGMIMKHKEHDTPVE
RKVSTGISFLFMFLVGMSMPHFIGVNFAETHTGTHSVTGSQEMMSWGMILFHVVIVSFLS
NIGKLCPMFFYRDRKLSERLALSIGMFTRGEVGAGIIFIALGYNLGGPALVISVLTLVLN
LILTGIFVLWVKNLALRSYND