Protein Info for BT0589 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 618 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 340 to 360 (21 residues), see Phobius details amino acids 366 to 389 (24 residues), see Phobius details amino acids 440 to 462 (23 residues), see Phobius details amino acids 484 to 508 (25 residues), see Phobius details amino acids 528 to 546 (19 residues), see Phobius details amino acids 552 to 568 (17 residues), see Phobius details TIGR03593: membrane protein insertase, YidC/Oxa1 family, N-terminal domain" amino acids 2 to 360 (359 residues), 91.9 bits, see alignment E=6.4e-30 PF14849: YidC_periplas" amino acids 86 to 355 (270 residues), 120.9 bits, see alignment E=1e-38 PF02096: 60KD_IMP" amino acids 365 to 572 (208 residues), 196.5 bits, see alignment E=3.9e-62 TIGR03592: membrane protein insertase, YidC/Oxa1 family" amino acids 369 to 569 (201 residues), 174.5 bits, see alignment E=2.5e-55

Best Hits

Swiss-Prot: 100% identical to YIDC_BACTN: Membrane protein insertase YidC (yidC) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K03217, preprotein translocase subunit YidC (inferred from 100% identity to bth:BT_0589)

Predicted SEED Role

"Inner membrane protein translocase component YidC, long form"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AA76 at UniProt or InterPro

Protein Sequence (618 amino acids)

>BT0589 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MDKNTITGLVLIGILLVGFSYLSRPSEEQIAAQKKYYDSIAVVQQQQEALKAKTEAALAN
ENKGAAAAADSSALFFNAMHGTDSKVSIQNSVAEITFTTKGGRVYSAMLKEYKGQDKTNP
VVLFDGDDATMSFNFYNKQGAIQTKDYYFEAVNKTDSSVTMRLAADNASYIDFIYTLKPN
SYLMNFEIKATGMEGKLASTEYVDIDWTQRARQLEKGFTYENRLSELTYKVKGDNVDNLS
AAKDDEKDLGNTAIDWVAFKNQFFSSVFIADQDFNKVSVKSRMEQQGSGYIKDYSAEMST
FFDPSGKQPTEMYFYFGPNHFKTLKALDKGRTEKWELNRLVYLGWPLIRWINQFITINVF
DWLSGWGLSMGIVLLILTIMVKVVVYPATWKTYMSSAKMRVLKPKIDEINKKYPKQEDAM
KKQQEVMSLYSQYGVSPMGGCLPMLLQFPILMALFMFVPSAIELRQQSFLWADDLSTYDA
FITFPFHIPFLGNHLSLFCLLMTVTNILNTKYTMTMQDTGAQPQMAAMKWMMYLMPIMFL
FVLNDYPSGLNYYYFVSTLISVGTMILLRKTTDETKLLAILEAKKKDPKQMKKTGFAARL
EAMQKQQEQLQQQKQNKR