Protein Info for BT0579 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative transcription regulator (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 TIGR00011: Cys-tRNA(Pro) deacylase" amino acids 6 to 156 (151 residues), 202.7 bits, see alignment E=1.3e-64 PF04073: tRNA_edit" amino acids 33 to 147 (115 residues), 89.9 bits, see alignment E=6.9e-30

Best Hits

Swiss-Prot: 47% identical to YJDI_BACSU: Putative Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YjdI (yjdI) from Bacillus subtilis (strain 168)

KEGG orthology group: K03976, putative transcription regulator (inferred from 100% identity to bth:BT_0579)

Predicted SEED Role

"Cys-tRNA(Pro) deacylase YbaK"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AA86 at UniProt or InterPro

Protein Sequence (159 amino acids)

>BT0579 putative transcription regulator (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKINKTNAARLLDKAKIAYELIPYEVDENDLSAIHVAASLGENIEQVFKTLVLHGDKSGY
FVCVIPGEHEVDLKLAAKASGNKKCDLIPVKELLPLTGYIRGGCSPIGMKKHFPTYIHET
CRQFPYIYVSAGVRGLQIKLAPGDLIRESRAEICRLFEE