Protein Info for BT0528 in Bacteroides thetaiotaomicron VPI-5482

Updated annotation (from data): phosphoribosylanthranilate isomerase (EC 5.3.1.24)
Rationale: Important for fitness in most defined media and strongly cofit with anthranilate phosphoribosyltransferase (BT0530). 37% identical to phosphoribosylanthranilate isomerase from Thermotoga maritima (Q56320)
Original annotation: putative N-(5'-phosphoribosyl)anthranilate isomerase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00697: PRAI
  • amino acids 8 to 203 (196 residues), 110.5 bits, E=4.7e-36

Best Hits

Swiss-Prot: 52% identical to TRPF_BACV8: N-(5'-phosphoribosyl)anthranilate isomerase (trpF) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K01817, phosphoribosylanthranilate isomerase [EC: 5.3.1.24] (inferred from 100% identity to bth:BT_0528)

Predicted SEED Role

"Phosphoribosylanthranilate isomerase (EC 5.3.1.24)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 5.3.1.24)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• superpathway of chorismate metabolism (38/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.24

Sequence Analysis Tools

See Q8AAD7 at UniProt or InterPro

Protein Sequence (207 amino acids)

>BT0528 phosphoribosylanthranilate isomerase (EC 5.3.1.24) (Bacteroides thetaiotaomicron VPI-5482)
MINGKIIKVCGMREAQNIRDVESLQRVDMMGFIFYPKSPRYIYELPAYLPVHARRVGVFV
NEDKDVITMYADRFGLEYIQLHGKESPEYCQSLRTSGLKIIKAFSVARPKDLNHVSEYEK
TCNLFLFDTKCEQYGGSGNQFDWNILHTYNGQVPFLLSGGINSHSANALKAFDHPRLAGY
DLNSRFELKPGEKDPERIRIFLNELKS