Protein Info for BT0475 in Bacteroides thetaiotaomicron VPI-5482
Annotation: putative phosphoheptose isomerase (NCBI ptt file)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 60% identical to GMHA2_CAMJE: Phosphoheptose isomerase 2 (gmhA2) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
KEGG orthology group: K03271, phosphoheptose isomerase [EC: 5.-.-.-] (inferred from 100% identity to bth:BT_0475)MetaCyc: 59% identical to D-sedoheptulose 7-phosphate isomerase (Aneurinibacillus thermoaerophilus)
RXN0-4301 [EC: 5.3.1.28]
Predicted SEED Role
"Phosphoheptose isomerase (EC 5.3.1.-)" in subsystem Capsular heptose biosynthesis or LOS core oligosaccharide biosynthesis (EC 5.3.1.-)
MetaCyc Pathways
- GDP-D-glycero-α-D-manno-heptose biosynthesis (1/4 steps found)
- ADP-L-glycero-β-D-manno-heptose biosynthesis (1/5 steps found)
KEGG Metabolic Maps
- Biosynthesis of ansamycins
- Biosynthesis of steroids
- Carotenoid biosynthesis - General
- Galactose metabolism
- Inositol phosphate metabolism
- Lipopolysaccharide biosynthesis
- Pentose and glucuronate interconversions
Isozymes
Compare fitness of predicted isozymes for: 5.-.-.-, 5.3.1.-
Use Curated BLAST to search for 5.-.-.- or 5.3.1.- or 5.3.1.28
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8AAI9 at UniProt or InterPro
Protein Sequence (197 amino acids)
>BT0475 putative phosphoheptose isomerase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482) MESIDIVRKQVAESERVKAELSKNEEVIAAIAKAADVCTEAYRRGNKTMFAGNGGSAADA QHLVGEFVSKFYFDRPGIPSIALTTDTSVITAIGNDYGYDKIFTRQLQAQGVAGDVFIGI STSGNSKNIVDALPICKEKGITTIALTGMKSCKMDDFDIVIKVPSAETPRIQECQTLIGH IICCIVEENIFGEEYNK