Protein Info for BT0423 in Bacteroides thetaiotaomicron VPI-5482

Annotation: translation initiation factor IF-3 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF05198: IF3_N" amino acids 12 to 80 (69 residues), 99.1 bits, see alignment E=1.3e-32 TIGR00168: translation initiation factor IF-3" amino acids 12 to 174 (163 residues), 185.2 bits, see alignment E=3.6e-59 PF00707: IF3_C" amino acids 87 to 172 (86 residues), 111.6 bits, see alignment E=1.4e-36

Best Hits

Swiss-Prot: 100% identical to IF3_BACTN: Translation initiation factor IF-3 (infC) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K02520, translation initiation factor IF-3 (inferred from 100% identity to bth:BT_0423)

Predicted SEED Role

"Translation initiation factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AAP1 at UniProt or InterPro

Protein Sequence (185 amino acids)

>BT0423 translation initiation factor IF-3 (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKNDTLKGQYRINEQIRAKEVRIVGDEIEPKVYPIFQALKMAEEKELDLVEISPNAQPPV
CRIIDYSKFLYQLKKRQKEQKAKQVKVNVKEIRFGPQTDDHDYNFKLKHARGFLEDGDKV
KAYVFFKGRSILFKEQGEVLLLRFANDLEDFAKVDQMPVLEGKRMTIQLSPKKRKCLKNR
RLPNR