Protein Info for BT0326 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative RNA polymerase ECF-type sigma factor (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF04542: Sigma70_r2" amino acids 14 to 75 (62 residues), 49.9 bits, see alignment E=3.3e-17 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 15 to 158 (144 residues), 91.6 bits, see alignment E=2.1e-30 PF08281: Sigma70_r4_2" amino acids 105 to 155 (51 residues), 55.3 bits, see alignment E=6.1e-19 PF04545: Sigma70_r4" amino acids 110 to 158 (49 residues), 34.6 bits, see alignment E=1.6e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0326)

Predicted SEED Role

"RNA polymerase ECF-type sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8AAY6 at UniProt or InterPro

Protein Sequence (173 amino acids)

>BT0326 putative RNA polymerase ECF-type sigma factor (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MELKQFKITVVPLRDKLLNYARRMTDDPSDAEDAVQEVMLKLWNLRQKLDEYRSIEAVAM
TMTHHLCMDMWRAKRPDTLSLDRVQAPTPSATPERLLEEKDEFRLMREIIDSLPTLQRTI
IRMKDIEEYETEEIAEITGCNAEAIRSNLSRARKKVREVYLQTIQERKRRNKA