Protein Info for BT0196 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative hexose phosphate transport protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 107 to 130 (24 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 161 to 185 (25 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details amino acids 322 to 343 (22 residues), see Phobius details amino acids 349 to 372 (24 residues), see Phobius details amino acids 381 to 402 (22 residues), see Phobius details amino acids 425 to 443 (19 residues), see Phobius details PF07690: MFS_1" amino acids 43 to 397 (355 residues), 168.6 bits, see alignment E=1.8e-53 PF03137: OATP" amino acids 189 to 339 (151 residues), 28.2 bits, see alignment E=6.1e-11

Best Hits

KEGG orthology group: K07783, MFS transporter, OPA family, sugar phosphate sensor protein UhpC (inferred from 100% identity to bth:BT_0196)

Predicted SEED Role

"putative hexose phosphate transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ABB4 at UniProt or InterPro

Protein Sequence (448 amino acids)

>BT0196 putative hexose phosphate transport protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MLKHLINFYKVSSPGPCNGDVMSSSGKRRLKYLQWSTFLSATFGYGMYYVCRLSLNVVKK
PIVDEGIFSETELGIIGSVLFFTYAVGKFTNGFLADRSNINRFMTTGLLVTALINLCLGF
SHSFILFAVLWGVSGWFQSMGAASCVVGLSRWFTDKERGSYYGFWSASHNIGEALTFIIV
ASIVSVCGWRYGFFGAGMVGLLGALIVWRFFHDSPESKGFPPVNVPKEKKTMSASETTDF
NKAQRQVLTMPAIWILALSSAFMYISRYAVNSWGVFYLEAQKGYSTLDASFIISISSVCG
IIGTMFSGVISDKLFGGRRNVPALIFGLTNVLALCLFLLVPGVHFWLDAVAMILFGLGIG
VLICFLGGLMAVDIAPRNASGAALGVVGIASYIGAGLQDVMSGVLIEGHKTIRSGVEVYD
FTYINWFWIGSAILSVFFALWVWNAKQK