Protein Info for BT0118 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative cytochrome c biogenesis protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 transmembrane" amino acids 13 to 40 (28 residues), see Phobius details amino acids 54 to 78 (25 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 172 to 197 (26 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details PF13386: DsbD_2" amino acids 17 to 228 (212 residues), 68.1 bits, see alignment E=5.1e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0118)

Predicted SEED Role

"Cytochrome c biogenesis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ABJ2 at UniProt or InterPro

Protein Sequence (235 amino acids)

>BT0118 putative cytochrome c biogenesis protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MDFLQSLLDNSSIPAITAFILGTLTAVSPCPLATNITAIGFISKDIENHHRIFINGLLYT
FGRIVTYTALGFILIPILREGASMFMVQKAVSKYGEMLIAPVLIIIGIFMLDIIKLNIPK
VNIGGEGLKKKTKGSWGAMLLGVLFALAFCPTSGVFYFGMLMPLAAAETGGYLLPVIYAI
ATGLPVILVAWILAYSVAGLGKFYNRVQIFEKWFRKIVAILFIAIGIYYAVILYL