Protein Info for BT0108 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 666 PF13155: Toprim_2" amino acids 235 to 322 (88 residues), 25.7 bits, see alignment E=1.2e-09 PF13481: AAA_25" amino acids 357 to 536 (180 residues), 35.4 bits, see alignment E=8.8e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0108)

Predicted SEED Role

"Toprim domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ABK2 at UniProt or InterPro

Protein Sequence (666 amino acids)

>BT0108 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MLRKEEILERTSNGLSVFKHYVPGNWRIGRNFLNPLYEDNKASCNIYFDRRSGIYKMKDF
GNDNYSGDCFFFVGQLKGLDCNNSMDFVEILETIDRDLGLGLATGNPIPVTRNSCRVVDN
ILEETPEKESKPYQFREQKFPLAELMYWQQYGITPEILELYKVCSLRDFQSVTADGTQFT
YTSSVTEPMYGYKSKRYIKLYRPFSKTRFLYGGNFGDNYCFGLEQLPAKGDTLFITGGEK
DVMSLAAHGFHAICFNSETVTVPPTLIYKLTFRFKHIILLYDTDKTGKESARKQEKQLEE
FSVKRLLLPLSGTKEEKDISDYFKAGNTREDFLKLFIEFLDNLYSDTLIMLKSCEIDFNN
PPAKAQVIISAGDVPLGTQGNLFGITGGEGTGKSNYIAAMLAGCICQPDKEVDTLGIQIT
ANSKRKAVLLYDTEQSEVQLFKNVSNLLARAKQPDKPEELKAFCLTGMSRKERLHAIVQS
MDKFYYQYGGIQLVVIDGIADLVKSANDEAESVAVIDELYRLAGIYNTCILCVLHFVPNG
LKLRGHLGSELQRKAATILSIEKDEEPTQSVVKALKVRDGSPLDVPLMLFAWDKAAGMHL
YKGEKPREEKEKRKEKELVCVARDIFGRQTHITYIDLCEQVAAGFGRERTYCQKLCSFHA
GTGYYH