Protein Info for BT0015 in Bacteroides thetaiotaomicron VPI-5482

Annotation: rteB, two-component system response regulator (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 PF00072: Response_reg" amino acids 4 to 113 (110 residues), 77.3 bits, see alignment E=3.7e-25 PF14532: Sigma54_activ_2" amino acids 129 to 298 (170 residues), 73.4 bits, see alignment E=8.1e-24 PF00158: Sigma54_activat" amino acids 129 to 293 (165 residues), 216.9 bits, see alignment E=5.2e-68 PF07728: AAA_5" amino acids 151 to 270 (120 residues), 32.7 bits, see alignment E=2.4e-11 PF02954: HTH_8" amino acids 393 to 429 (37 residues), 64 bits, see alignment 2.8e-21 PF13518: HTH_28" amino acids 394 to 429 (36 residues), 25.2 bits, see alignment 5e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_0015)

Predicted SEED Role

"Response regulator of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ABU5 at UniProt or InterPro

Protein Sequence (432 amino acids)

>BT0015 rteB, two-component system response regulator (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKSILIIEDDIVFSRTISNWLVKQGMKTQCVATIAEARRAIAGKPFSLILADMRLPDDNS
LSLLEWMRERRCTVPVIIMTNYGEVENAVTAIKLGATDYLRKPVQPDILLELIVGIKEGD
SGKPSFYRGESAKAQEMYRQIELIACADISVLLRGASGTGKEHVAHEIHERSHRWNKPYV
PVDCGTVPEELAASEFFGHLKGAFTGAESDKAGLFRTADGGTLFLDEIGNLSYRTQVMLL
RALQEKRYRPLGDTREYPFDIRLVAATNENLEKAIAEGRFREDLFHRLNEFTIRLPLLAE
CREDILPLADFFLEEANAELGKRTGGFDREARSRLAAYQWPGNMREMKNTVRGAVLLTPD
GERIAAGSLAFSVREADGADASETLALNDAQKEKECIMRALEETGGNRKEAARLLGISRS
TLYEKLRKYGFQ