Protein Info for p5482_33 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative DNA-binding protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 PF13310: Virulence_RhuM" amino acids 62 to 173 (112 residues), 74.3 bits, see alignment E=5.1e-25

Best Hits

KEGG orthology group: None (inferred from 99% identity to osp:Odosp_1699)

Predicted SEED Role

"Putative DNA-binding protein in cluster with Type I restriction-modification system" in subsystem Restriction-Modification System

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8ABW5 at UniProt or InterPro

Protein Sequence (276 amino acids)

>p5482_33 putative DNA-binding protein (NCBI) (Bacteroides thetaiotaomicron VPI-5482)
MEQGEIILYQPDEAVKLEVRLEDETVWLTQEQIADLFGTKRPAITKHLNNIYKSGELDID
STCSILEHMGNDGKQRYTTKYYNLDAILSIGYRVNSKNATLFRKWANSVLKDYLLKGYSI
NKRLSELERTVAQHTEKIDFFVRTALPPVEGIFYNGQIFDAYKFATDLVKSARRSIVLID
NYVDETVLLMLSKRSVGVSATIYTQRITQQLQLDLDRHNSQYPPIDIRTYRDSHDRFLIV
DETDVYHIGASLKDLGKKMFAFSKLDIPAAVITDLL