Protein Info for DVUA0138 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensor histidine kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 694 signal peptide" amino acids 1 to 55 (55 residues), see Phobius details transmembrane" amino acids 234 to 254 (21 residues), see Phobius details amino acids 264 to 286 (23 residues), see Phobius details amino acids 301 to 321 (21 residues), see Phobius details amino acids 330 to 348 (19 residues), see Phobius details amino acids 354 to 373 (20 residues), see Phobius details amino acids 385 to 402 (18 residues), see Phobius details amino acids 414 to 433 (20 residues), see Phobius details PF07695: 7TMR-DISM_7TM" amino acids 235 to 435 (201 residues), 79 bits, see alignment E=9.6e-26 PF07730: HisKA_3" amino acids 478 to 537 (60 residues), 33.5 bits, see alignment 9.8e-12 PF02518: HATPase_c" amino acids 584 to 675 (92 residues), 49.2 bits, see alignment E=1.3e-16 PF13581: HATPase_c_2" amino acids 586 to 649 (64 residues), 28.4 bits, see alignment E=2.9e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVUA0138)

Predicted SEED Role

"Adenylate cyclase (EC 4.6.1.1)" in subsystem cAMP signaling in bacteria (EC 4.6.1.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.6.1.1

Use Curated BLAST to search for 4.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72WF1 at UniProt or InterPro

Protein Sequence (694 amino acids)

>DVUA0138 sensor histidine kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKRATSPPHGPMMNRNAPRLSFPTRMLRAFHPVPLLVVLLVSVFILPPYGPARAADGLQA
EDGVLDLRDFDPETMGPARLDGAWEFYWDRLLTPQDLAANPAPSPSGLLSLPGTWRGMPV
DGERLGGTGQATLRLRLRLWPEANTLTLRLFDIPMAYRLWANGQLVAMNGVVGTDADSET
PLRSLVLATITPEGENLELVLQISNHHFRAGGVPEGLLLAPPGPLETERDRTWTFSYFFA
GCLLITLLYHLFLFHLDRKQVSAGYFSGFCLCILCFCMTSNTSFWAIRRFLPPLPPQWSE
YVPLFFYMACAPMLFRFYYSLYPKVFHPAVRHLVDLRFAIFLLLLPIAPDHRISEYIAFS
ILVGLGCAIYYVVRLCSCARRGMNGAGLLLLGSAASLLASLNDGLSHIKHINTPYLIEFG
MLFLIVTQSLALAKRFSHAFASVGKLSGELERKNQSLLAEMEERNRLEQEVINISEEERR
RISHELHDGLCQKLTGARLRASILSKRLAGTDDSTTMDSLAALLDASTDDAYRTSRGLWP
VEHDPAMPGPSLDDLARRIAKDTGIDVRLEMRRHCGRCTNPNMRTLYRIAQEALTNAAKH
AQAHTIRVRLRCPAQDGVILTVRDDGIGRTASARQGARTGGLGLGIMAHRAGVIHAKLTI
EDAPQGGTIVTCAAPCDRHASPSSTRRTPPDASR